PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA002172-PA
Common NameOsI_00807
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BES1
Protein Properties Length: 334aa    MW: 35662.9 Da    PI: 8.6842
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA002172-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822205.31.8e-6311446150
            DUF822   6 kptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                       +ptw+ErEnnkrRERrRRaiaaki+aGLRa+G+yklpk++DnneVlkALc+eAGwvve+DGttyrkg+kp+e++e++g+s s sp+ss+q   
  BGIOSGA002172-PA   1 MPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPDGTTYRKGYKPPERMEVIGCSVSPSPCSSYQ--- 90 
                       69****************************************************************************************... PP

            DUF822  99 kssalaspvesysaspksssfpspssldsislasa.......asllpvlsvlslvsssl 150
                            +sp++sy+asp+sssfps +s+ ++++ ++       + +lp+l++ls+++ss+
  BGIOSGA002172-PA  91 -----PSPRASYNASPTSSSFPSGASSPFLPHPNNmangvdgNPILPWLKTLSNSPSSK 144
                       .....99*******************999999988999999999********9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.6E-631138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MPTWRERENN KRRERRRRAI AAKIFAGLRA HGGYKLPKHC DNNEVLKALC NEAGWVVEPD  60
GTTYRKGYKP PERMEVIGCS VSPSPCSSYQ PSPRASYNAS PTSSSFPSGA SSPFLPHPNN  120
MANGVDGNPI LPWLKTLSNS PSSKKHPQLP PLLIHGGSIS APVTPPLSSP TARTPRMKTD  180
WDESNVQPTW TGSNSPCVVN STPPSPGRTM LPDPAWLAGI QISSTSPSSP TFSLVSSNPF  240
SVFKDAIPVG NNSSRMCTPG QSGTCSPAIP GMAPHPDIHM MDAVSDEFAF GSSTNGGHQA  300
AGLVRAWEGE RIHEDSGSDD LELTLGSSRT RAAA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.13020.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329774890.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0674710.0AK067471.1 Oryza sativa Japonica Group cDNA clone:J013107L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622415.10.0PREDICTED: protein BZR1 homolog 2
SwissprotQ0JPT40.0BZR2_ORYSJ; Protein BZR1 homolog 2
TrEMBLB8A6K90.0B8A6K9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA002172-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.15e-82BES1/BZR1 homolog 4